PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0180s0250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 229aa    MW: 25539 Da    PI: 10.3557
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0180s0250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS122.93.8e-384119979244
                    GRAS  79 aalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerL 165
                              a+   ++  Pi ++ +lta qa+ e v +++++H iD++i  G+QW aL+qaLa+R++   +l+iT+vg       +++ee g+rL
  SapurV1A.0180s0250.1.p  41 LAHLSVHQKAPINQIMQLTAIQAMKENVGSARKIHLIDLEIWSGVQWTALMQALADRQSRLDRLKITAVGL---RGIQKIEENGKRL 124
                             2233378889************************************************************9...5799********* PP

                    GRAS 166 akfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                             + fA+++++pf f+++ ++ +++++ e +++  +E+++V   + l ++l+++++l++    ++ ++k+++P +++v e+
  SapurV1A.0180s0250.1.p 125 ETFAKSMNLPFTFKPVEVSCMSEIKEELFETAADETVVVVANMILRTMLSRPACLQN----LMGVIKNINPSLMIVGEN 199
                             *************************************************99999999....***************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098524.2381228IPR005202Transcription factor GRAS
PfamPF035141.3E-3541199IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MFIQFAEALR LRNDKATGRF PPAEMKGKPK CVTPHGLSTH LAHLSVHQKA PINQIMQLTA  60
IQAMKENVGS ARKIHLIDLE IWSGVQWTAL MQALADRQSR LDRLKITAVG LRGIQKIEEN  120
GKRLETFAKS MNLPFTFKPV EVSCMSEIKE ELFETAADET VVVVANMILR TMLSRPACLQ  180
NLMGVIKNIN PSLMIVGENG NCLIVGWEGA PLHSLSARKF SRERPWRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-17319845241GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320295.21e-120hypothetical protein POPTR_0014s11510g
TrEMBLB9I9I41e-120B9I9I4_POPTR; Uncharacterized protein
STRINGPOPTR_0014s11510.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-21RGA-like 2